PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G146100.1
Common NamePHAVU_004G146000g, PHAVU_004G146100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family BBR-BPC
Protein Properties Length: 284aa    MW: 31439.1 Da    PI: 10.3827
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G146100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind353.64.2e-10812831301
           GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdaki.rernlalsekkaavaerd.........maflqrdkalaernkalverdnk 80 
                         md d+  + rn+gyyepa+s+k++lglqlmss++e+     r++ + ls++++a+++rd         m++ +rd+++++       +++k
  Phvul.004G146100.1   1 MDGDNGLNiRNWGYYEPATSFKSHLGLQLMSSMPEKPLIGgRNAAV-LSGTNGAFHHRDigmsqttypMEY-MRDAWMSS-------QREK 82 
                         888888888*************************988766355555.9***********************.9*****99.......899* PP

           GAGA_bind  81 llalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkks 171
                         ++++++++++        ++ +++t+s++++q+     + ++  + +ee+ +e++p++e    +    ++kkrq++k+pk++kakk k+ +
  Phvul.004G146100.1  83 YMNMIPTNHN--------YGGIPETSSAHHIQM-----IPPPELP-KEERAVEEEPVVE----KASGGTRKKRQSPKVPKSPKAKKSKRGP 155
                         ******9997........99************9.....3344444.4455555566555....445566777899**************99 PP

           GAGA_bind 172 ekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSq 262
                         +++k+++++    +r++ +kk++++v+ng+++D+s++P+PvCsCtG ++qCY+WG+GGWqSaCCtt +SvyPLP+stkrrgaRiagrKmS 
  Phvul.004G146100.1 156 RVPKNENAPTV--QRARVPKKTTEIVINGIDMDISSIPIPVCSCTGGPQQCYRWGSGGWQSACCTTGMSVYPLPMSTKRRGARIAGRKMSI 244
                         99977777777..79**************************************************************************** PP

           GAGA_bind 263 gafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         gafkk+LekLaaeGy++snp+DL+++WAkHGtnkfvtir
  Phvul.004G146100.1 245 GAFKKVLEKLAAEGYNFSNPIDLRTYWAKHGTNKFVTIR 283
                         **************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012264.9E-1671283IPR010409GAGA-binding transcriptional activator
PfamPF062171.5E-1121283IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MDGDNGLNIR NWGYYEPATS FKSHLGLQLM SSMPEKPLIG GRNAAVLSGT NGAFHHRDIG  60
MSQTTYPMEY MRDAWMSSQR EKYMNMIPTN HNYGGIPETS SAHHIQMIPP PELPKEERAV  120
EEEPVVEKAS GGTRKKRQSP KVPKSPKAKK SKRGPRVPKN ENAPTVQRAR VPKKTTEIVI  180
NGIDMDISSI PIPVCSCTGG PQQCYRWGSG GWQSACCTTG MSVYPLPMST KRRGARIAGR  240
KMSIGAFKKV LEKLAAEGYN FSNPIDLRTY WAKHGTNKFV TIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152630.10.0hypothetical protein PHAVU_004G146100g
RefseqXP_007152631.10.0hypothetical protein PHAVU_004G146100g
RefseqXP_007152629.10.0hypothetical protein PHAVU_004G146000g
RefseqXP_007152627.10.0hypothetical protein PHAVU_004G146000g
RefseqXP_007152628.10.0hypothetical protein PHAVU_004G146000g
SwissprotQ9SKD04e-94BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLV7C5Q60.0V7C5Q6_PHAVU; Uncharacterized protein
STRINGGLYMA09G30040.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.32e-87basic pentacysteine 2